Genomics pipeline

Sequencing platform: Oxford Nanopore

Author

Ana V. Lasa (ana.lasa@eez.csic.es)

0. Introduction

In this tutorial you will learn how to perform genomics analyses. We will go through all the steps needed: from the processing of raw sequencing reads coming from MinION (Nanopore) platform until the obtaining of quality genomes.

0.1 Requirements

This pipeline has been set up on a Linux server (Ubuntu distribution), with 96 cores and 500 MB of RAM memory. You have to be careful and change some parameters according to the computational power of your machine.

Furthermore, here we assume that all the packages, programs, conda environments, and databases are already correctly installed. Otherwise, you must install or download all of them as the first step.

Some knowledge of bash is also desirable.

Programs and their versions used in this pipeline
Program Version
MinKNOW v.24.06.16
Dorado v.7.4.14
Porechop v.0.2.4
NanoPlot v.1.46.2
chopper v.0.8.0
flye v.2.9.5-b1801
QUAST v.5.2.0
CheckM2 v.1.1.0
GTDB-tk v.2.6.1
TYGS (web server) last accessed: 09/03/2026
JSpecies (web server) last accessed: 09/03/2026
ResFinder (database) v.2.6.0
Platon v.1.7
IntegronFinder v.2.0.3
geNomad v.1.11.2
VFDB (database) last accessed: 11/03/2026
Bakta v.1.12.0
eggNOG-mapper v2.1.12
MacSyFinder v.2.1.6
TXSScan models v.1.1.4
antiSMASH v.8.0.4
dbCAN v.3.0.7
PHI-database v.4.19 last accessed: 12/03/2026
RepeatModeler v.2.0.2
RepeatMasker v.4.1.2-p1

0.2 Some useful tricks

-Remember that if you want to create or modify an script, you can write in the terminal:

nano name_of_the_script.sh (or whichever editor you use)

This command will open the nano text-editor, where you can write or paste your script. There are some keyboard shortcuts to manage the text editor.

If the script is written in bash, then you have to write this in the terminal to execute the script:

bash name_of_the_script.sh

-Preferably work with screens. Some steps are very time-consuming, so it is necessary to run them on a screen. Hence, you can leave the server working when you go home to rest, or you can use the server to perform other analyses meanwhile. Working with screen is mandatory if you have internet connection problems.

To create a screen, just run this command: screen -S name_of_screen. Once created, you can detach it and continue working on your server with this keyboard shortcut: ctr + a (and then) d

1. Getting started with Minknow software

For this example, we used the flow cell type FLO-MIN114, and the kit type SQK-RBK114-24. At first, our flow cell contained 1651 alive pores, but after loading the samples it dropped to 1313 pores. The scanning of the pores was performed each 1.5 hours. The base-calling was performed with the software Dorado and the model HAC (High Accyrary). You can run it on your Linux server following this pipeline. All the raw read with quality values < Q9 were removed from the dataset. POD5 files were saved once an hour.

2. Prepare the data

The files obtained by MinKNOW should be in the fastq format, preferably compressed (.fastq.gz extension). Let’s assume that the name of our directory is fastq_pass. There we will find several directories, one for each barcode used in the sequencing. It is quite common to find more barcodes that those we used, and therefore more directories than samples we had. It could be due to sequencing errors. Check the size of that exceeding directories, and probably, they are much smaller than the expected ones. You can check it by running this command: ls -l path_to_your_project/fastq_pass/ or du path_to_your_project/fastq_pass/. Have a look at our example:

drwxrwxr-x 2 ana ana 24576 ene 21 10:47 barcode01
drwxrwxr-x 2 ana ana 20480 ene 21 10:48 barcode02
drwxrwxr-x 2 ana ana 12288 ene 21 10:48 barcode03
drwxrwxr-x 2 ana ana 32768 ene 21 10:49 barcode04
drwxrwxr-x 2 ana ana 20480 ene 21 10:49 barcode05
drwxrwxr-x 2 ana ana 20480 ene 21 10:50 barcode06
drwxrwxr-x 2 ana ana 20480 ene 21 10:50 barcode07
drwxrwxr-x 2 ana ana 20480 ene 21 10:51 barcode08
drwxrwxr-x 2 ana ana 12288 ene 21 10:51 barcode09
drwxrwxr-x 2 ana ana 16384 ene 21 10:51 barcode10
drwxrwxr-x 2 ana ana 12288 ene 21 10:51 barcode11
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode12
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode13
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode14
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode15
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode16
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode17
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode18
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode19
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode20
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode21
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode22
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode23
drwxrwxr-x 2 ana ana  4096 ene 21 10:51 barcode24

In our example, we sequenced 11 bacterial genomes. As you can see, directories barcode01 - barcode11 are much bigger than the others.

You can delete the extra directories if you want (barcode12 - barcode24, in our example). Remember that it can be achieved by the command rm -r name_directory.

2.1 Index your samples

We need to create a new file that indicates which samples each barcode corresponds to. To do this, we create a new file named barcode_list.txt containing two columns separated by a tab:

-First column: barcodecodes (“barcode01”)
-Second column: sample names (“Pseudomonas_p3”)
Note

You can write it manually, but it is preferable to automate the writing with a script. The more we write by hand, the more likely we are to make mistakes.

So, run this: ls ./fastq_pass/ > barcode_list.txt. Look at our file:

barcode01       Pseudomonas_p3
barcode02       Pseudomonas_p19
barcode03       Pseudomonas_p43
barcode04       Pseudomonas_p52
barcode05       Pseudomonas_p60
barcode06       Pseudomonas_p61
barcode07       Arthrobacter_AFG7.2
barcode08       Arthrobacter_AFG20
barcode09       Bradyrhizobium_GV137
barcode11       Luteibacter_L7

2.2 Join fastq files

If we go into the directory related to one of the barcodes, we will see there many fastq files. This is because the MinION generates numerous files for security reasons. For instance, when it sequences a certain number or reads (or periodically), it stores the sequencing results and generates a new file (this can be change during the setting up of the sequencing project). This strategy is very useful for preventing the loss of all data in case of any unforeseen circumstances (e.g., a power outage). Eventually, we will find many fastq files in the corresponding directory. Look at our example:

~/Genomas_nanopore/fastq_pass/barcode01$ ls
It looks like:

fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_0.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_34_1.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_1.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_34_2.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_2.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_34_3.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_3.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_34_4.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_4.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_3_4.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_0_5.fastq.gz   fastq_runid_128c1e43c550283377174b78dd969327379b2983_35_0.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_10_0.fastq.gz  fastq_runid_128c1e43c550283377174b78dd969327379b2983_35_1.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_10_1.fastq.gz  fastq_runid_128c1e43c550283377174b78dd969327379b2983_36_0.fastq.gz
fastq_runid_128c1e43c550283377174b78dd969327379b2983_10_2.fastq.gz  fastq_runid_128c1e43c550283377174b78dd969327379b2983_36_1.fastq.gz

[...]

Let’s join all the fastq files corresponding to the same barcode (sample) into just one file:

#!/usr/bin/env bash
set -euo pipefail

INPUT_TABLE="/home/ana/Genomas_nanopore/barcode_list.txt" #path to the file that contains the relation between samples and barcodes
FASTQ_DIR="/home/ana/Genomas_nanopore/fastq_pass" #path to the directory containing the sub-directories according to barcodes (and raw reads inside)
OUT_DIR="/home/ana/Genomas_nanopore/00.raw_reads" #ouput directory

mkdir -p "$OUT_DIR" #create the output directory

while IFS=$'\t' read -r folder sample; do

    echo "......merging fastq files from ${folder} to ${OUT_DIR}/${sample}.fastq"

    zcat "${FASTQ_DIR}/${folder}"/* >> "${OUT_DIR}/${sample}.fastq" #zcat because fastq diles were compressed (.fastq.gz)

done < "$INPUT_TABLE"

Check if the script has created just one .fastq file (decompressed) by sample.

3. Trimming of the sequences

It is time to remove the Nanopore adapters using during the sequencing. For that purpose, we are going to use the tool Porechop, which looks for the adapters and removes them.

This process takes some time, so it is best to run it on a new screen. It is advisable to parallelize the process, especially if we have many samples.

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #indicate the name of the environment where Porechop is loaded

RAW_DIR="/home/ana/Genomas_nanopore/00.raw_reads" #path to the directory storing the raw reads (1 fastq file per sample)
OUT_DIR="/home/ana/Genomas_nanopore/01.reads_porechop" #output directory

N_JOBS=2 #number of jobs to run in parallel. Set it up according to your server

THREADS=48 #number of threads per job. Set it up according to your server

#activate the conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUT_DIR" #create the output directory

echo "......running porechop on reads in $RAW_DIR"

ls "$RAW_DIR" | parallel -j "$N_JOBS" \
    porechop \
        -i "$RAW_DIR"/{} \
        -o "$OUT_DIR"/{} \
        --threads "$THREADS"
echo "......porechop finished"

The output of the script is a fastq file for each sample.

4. Analysis of the quality of the reads

To check different quality parameters, we will use the tool NanoPlot1. This tool is very useful because it gives us many different parameters and also nice plots.

#!/bin/bash
set -euo pipefail

input_dir="/home/ana/Genomas_nanopore/01.reads_porechop" #path to the directory storing trimmed reads
output_dir="/home/ana/Genomas_nanopore/02.NanoPlot_results" #output directory

THREADS=78
MAXLENGTH=300000

mkdir -p "$output_dir" #create the output directory

# Loop over all the fastq files in the input directory
for f in "$input_dir"/*.fastq; do
    # Extract the samples' name
    base=$(basename "$f")

    sample_out="$output_dir/${base%.fastq}"
    mkdir -p "$sample_out"

    # Run NanoPlot
    NanoPlot \
        -t "$THREADS \ #multithreading
        --fastq "$f" \ #input fastq files
        --maxlength "$MAXLENGHT \ # Hide reads longer than length specified
        --plots dot \ #type of bivariate plot to make
        -o "$sample_out"

done

As a result, a directory is generated for each of the samples we have. In turn, each of the directories will contain all of these files:

-LengthvsQualityScatterPlot_dot (.htmland .png extensions)

-Non_weightedHistogramReadlength (.htmland .png extensions)

-WeightedLogTransformed_HistogramReadlength (.htmland .png extensions)

-Non_weightedLogTransformed_HistogramReadlength (.htmland .png extensions)

-Yield_By_Length (.htmland .png extensions)

-WeightedHistogramReadlength (.htmland .png extensions)

-NanoPlot_date.log

-NanoPlot-report.html

-NanoStats_post_filtering.txt

-NanoStats.txt

In order not to lengthen this pipeline we are not going into the details of each file. You can delve into them if your are interested. Here we suggest you to pay special attention to the number of sequences, N50 values, mean read length, and mean read quality.

5. Filtering of the sequences

Now it is time to remove low-quality reads from our data. For that end, we can use different efficient tools, such as Nanofilt or chopper2.

5.a) NanoFilt

We will use this software to remove that reads with an associated quality score < 10, although it is also possible to perform the filtering by size. Even though this software is efficient and gives nice results, it will no longer receive any updates. Take it into consideration for further analyses.

Run these command lines:

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #indicate the name of the conda environment that hosts chopper

INPUT_DIR="/home/ana/Genomas_nanopore/01.reads_porechop" #path to the trimmed reads

OUTPUT_DIR="/home/ana/Genomas_nanopore/03.nanofilt_results"#output directory

MIN_QUALITY=10 #minimum desired quality. Change it according to your needs. You may check the report given by Minknow to have an idea

#activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the output directory

#Loop over all fastq files in the input directory
for f in "$INPUT_DIR"/*.fastq; do

    base=$(basename "$f")

    echo "......filtering reads from $base"

    NanoFilt -q "$MIN_QUALITY" < "$f" > "$OUTPUT_DIR/$base"

done

echo "......NanoFilt finished"

This script just stores the filtered quality reads into fastq files, but does not give you more information. If you want to check the effect of the filtering, or more data about the quality sequences, now you can run again NanoPlot. For that purpose, run the script proposed in the section 4. Analysis of the quality of the reads of this pipeline, adapting the input and outputs directories accordingly.

5.b) Chopper

This program is based on NanoFilt, also gives nice results. If you decide to perform the quality filtering of the reads by means of chopper instead of NanoFilt, you just have to run the following script. It will create also a summary report.

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #indicate the name of the environment were chopper is loaded

INPUT_DIR="/home/ana/Genomas_nanopore/01.reads_porechop" #path to the trimmed reads
OUTPUT_DIR="/home/ana/Genomas_nanopore/03.chopper_results" #output directory

MIN_QUALITY=10 #minimum qscore

SUMMARY_FILE="$OUTPUT_DIR/filtering_summary.tsv" #the name of the summary report

#activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the output directory

echo -e "sample\treads_before\treads_after" > "$SUMMARY_FILE"

#Loop over all the fastq files
for f in "$INPUT_DIR"/*.fastq; do

    base=$(basename "$f")
    output_file="$OUTPUT_DIR/$base"

    echo "......filtering reads with chopper for $base"
    
    #count the number of trimmed reads (prior to the filtering)
    reads_before=$(($(wc -l < "$f") / 4))

    #perform the filtering
    chopper -q "$MIN_QUALITY" < "$f" > "$output_file"

    #count the number of filtered reads
    reads_after=$(($(wc -l < "$output_file") / 4))

    echo -e "${base}\t${reads_before}\t${reads_after}" >> "$SUMMARY_FILE"

done

echo "......chopper filtering finished"
echo "......summary written to $SUMMARY_FILE"

As a result, these command lines create a report named filtering_summary.tsv, which looks like:

sample            reads_before    reads_after
Pseudomonas_p19.fastq   744282  742316
Pseudomonas_p3.fastq    1163302 1160436

In this pipeline, we will use just the results given by chopper, but you can use the program you prefer.

6. Assembly reads into contigs

We are going to assembly all the quality reads into contigs for each sample. For that purpose, we will use the tool Flye3. This software is very powerful, since it assembles the reads into contig and also performed the polishing of the assemblies, which improved the quality of the genomes.

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #write the name of the conda environment where Flye is installed

INPUT_DIR="/home/ana/Genomas_nanopore/03.chopper_results" #path to the directory containing the filtered reads. If you worked with NanoFilt, just change the path to the directory where its outputs are stored. 

OUTPUT_DIR="/home/ana/Genomas_nanopore/04.contigs_flye" #output directory

THREADS=64

#activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the output directory

#Loop over all fastq files
for f in "$INPUT_DIR"/*.fastq; do

    base=$(basename "$f" .fastq)
    sample_out="$OUTPUT_DIR/$base"

    echo "......assembling sample $base with Flye"

     flye \
            --nano-hq "$f" \ #indicate the sequencing technology (ONT, high-quality), since it also works with PacBio reads
            --out-dir "$sample_out" \
            --threads "$THREADS"
    
done

echo "......Flye assembly finished"

As a result, a new file is created for each genome. In turn, different files and directories are also created inside each directory, namely 00-assembly, 20-repeat, 40-polishing, assembly_graph.gfa, assembly_info.txt, params.json, 10-consensus, 30-contigger, assembly_graph.gv, flye.log, and assembly.fasta. If you want more details of all these files, you can have a look a the Flye’s user manual. In brief, assembly.fastacontain the nucleotide sequences of each contig in fasta format, while assembly_info.txtshows as the name of the contig, its length and coverage, whether it is circular o not, among other parameters:

head -n 5 assembly_info.txt #this command gives us:

#seq_name       length  cov.    circ.   repeat  mult.   alt_group       graph_path
contig_1        7007749 308     Y       N       1       *       1
Note

Even if you we asked for 5 lines of the file (head -n 5) it shows us just 1 line. This is because long-reads sequencing platforms such as Oxford Nanopore or PacBio it is very common to assemble the entire bacterial genomes in pairs or even single contigs, as in our example.

7. Check the quality of the assemblies

Each fasta file is stored in a different directory, so first we will move them to a common folder. Moreover, we will rename the fasta file to identify the sample they come from:

#!/usr/bin/env bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/04.contigs_flye" #path to the directory where the fasta files coming from Flye are stored

OUTPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #output directory

mkdir -p "$OUTPUT_DIR" #create output directory


for dir in "$INPUT_DIR"/*/; do

    sample=$(basename "$dir") #extract the name of the sample
    fasta="$dir/assembly.fasta"
    output_file="$OUTPUT_DIR/${sample}_assembly.fasta" #edit this line to adapt the name of final fasta according to your interests

    echo "......renaming contigs for sample $sample"

    awk -v s="$sample" '
        /^>/ { sub(/^>/, ">" s "_", $0) }
        { print }
    ' "$fasta" > "$output_file"

done

Look at the results:

ls ./05.renamed_contigs_fasta/
Pseudomonas_p19_assembly.fasta  Pseudomonas_p3_assembly.fasta

Now, we have to check the quality of the assembled genomes, and we can do that in different ways:

7.a) QUAST software

We can use a script written in Python to evaluate the quality of the assembly. Specifically, we can use the quast.py script, whose main usage is already described in this website4.

#!/bin/bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" # path to the folder contained the renamed fasta files of the assembled contigs
OUTPUT_BASE="/home/ana/Genomas_nanopore/06.quast_results" #output directory (parent folder)

mkdir -p "$OUTPUT_BASE" 

#Looper over all fasta files 
for fasta in "$INPUT_DIR"/*.fasta; do
    # Extract the base name of the fasta files (without the extension)
    sample_name=$(basename "$fasta" .fasta)

    # Create output directory for each sample/genome
    OUTPUT_DIR="$OUTPUT_BASE/$sample_name"
    mkdir -p "$OUTPUT_DIR"

    echo "Processing $sample_name ..."

    # Run Quast
    quast.py -m 0 -t 64 "$fasta" -o "$OUTPUT_DIR"

    echo "Results stored in: OUTPUT_DIR"
done

The script creates a directory for each genome/sample, and inside each folder, you can find different files. We recommend having a look at the file report.pdf, where you can find the total number of contigs, the size of the contig(s), GC %, N50 and N90 values, and some useful plots.

7.b) CheckM2 software

Software CheckM25 is a machine learning-based tool that predicts the completeness and contamination of bacterial genomes or bins.

First of all, you need to download and install the external DIAMOND database CheckM2 relies on for rapid annotation. For that purpose, you can run this command:

wget https://zenodo.org/records/14897628/files/checkm2_database.tar.gz?download=1 #downloads the database from Zenodo repository

The database will be downloaded compressed in .tar.gz format, so you will need to decompress it as follows:

tar -xvzf checkm2_database.tar.gz

Now, it is time to run CheckM2 over all the fasta files:

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="checkm2" #indicate the name of conda environment where Checkm2 is already installed

INPUT_DIR="/home/ana/quarto/05.renamed_contigs_fasta" #path to the folder containing all the already assembled genomes
OUTPUT_DIR="/home/ana/quarto/07.checkm2_results" #output directory

CHECKM2_DB="/home/ana/quarto/CheckM2_database/uniref100.KO.1.dmnd" #path to DIAMOND's database

THREADS=64

EXTENSION="fasta" #extension of your fasta files. Change it accordingly

#activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create output directory

echo "......running CheckM2 on contigs in $INPUT_DIR"

checkm2 predict \ 
    -i "$INPUT_DIR" \
    -o "$OUTPUT_DIR" \
    -t "$THREADS" \
    --remove_intermediates \ # it removes all intermediate files (protein files, diamond output)
    -x "$EXTENSION" \
    --force \ #overwrite output directory
    --database_path "$CHECKM2_DB"

echo "......CheckM2 analysis finished"
echo "......results written to $OUTPUT_DIR"

As a result, the logfile and a report are given, namely quality_report.tsv. This file contains information about the assembly quality for each sample. For instance, you can know the completeness level (%), the contamination percentage, N50 values, genome size (bp), total GC content (%), and son on.

It is recommended that genomes be as little fragmented as possible (the fewest possible contigs), with a contamination percentage lower than 5%, completeness greater than 90%, and the highest possible N50 and coverage values.

8. Taxonomic assignment

There different programs that can perform the taxonomic assignment of the contigs. Here we will show the most common ones.

Note

Remember the current taxonomy new species description boundaries. If two prokaryotes show ANI values lower than 95%, they can be considered different species. If dDDH value between two prokaryotic genomes < 70%, they can be considered different species.

8.a) GTDB-Tk

The tool GTDB-Tk6 is specially designed for assigning taxonomy to bacterial and archaeal genomes. It is based on the Genome Database Taxonomy, which included more than 730.000 prokaryotic genomes. The database also includes environmental MAGs, so they cannot be validated by the LPSN (List of Prokaryotic names with Standing in Nomeclature) or IJSEM (International Journal of Systematic and Evolutionary Microbiology). Thus, although this database is really useful and helpful in assigning taxonomy, maybe you prefer to use another tools if you are trying to describe potential new species.

The first step is to download the database and decompress it:

wget https://data.ace.uq.edu.au/public/gtdb/data/releases/latest/auxillary_files/gtdbtk_package/full_package/gtdbtk_data.tar.gz

tar xvzf gtdbtk_data.tar.gz -C desired/path/to/store/it #change it accordingly if you want to store the decompressed file in a specific path
Warning

The file is higher than 130 GB, so the downloading step takes more than 4 h in our server.

After decompressing the database, it is necessary to create an environment variables so that the program knows where the database is located. We can indicate it and

export GTDBTK_DATA_PATH=/path/to/the/database #change the path accordingly

You can also add this line inside the following script, just before running GTDB-Tk. In this example, we will include the creation of the environment variable inside the following script:

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #write the name of the conda environment where GTDB-Tk is installed

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory containing the assembled genomes

OUTPUT_DIR="/home/ana/Genomas_nanopore/08.taxonomy_gtdb" #output directory

#create the environment variable
export GTDBTK_DATA_PATH=/home/ana/Genomas_nanopore/release226 #path to the GTDB-Tk database. Change it according to your path

THREADS=64

EXTENSION="fasta" #extension of the genomes' fasta file. Change it according to your data

#Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the ouput directory

echo "......running GTDB-Tk taxonomy classification"

gtdbtk classify_wf \ #classify workflow
    --genome_dir "$INPUT_DIR" \
    --out_dir "$OUTPUT_DIR" \
    --cpus "$THREADS" \
    -x "$EXTENSION" \
    --skip_ani_screen #Skip the skani ANI screening step to classify genomes

echo "......GTDB-Tk classification finished"
echo "......results written to $OUTPUT_DIR"

This script creates a directory containing several different files

In this pipeli, we will focus solely on the file named gtdbtk.bac120.summary.tsv. This one includes information about the potential taxonomical classification, the reference of the closest genome, its ANI values, among other. Please, check the user manual to gain more details about the ouputs and their meaning.

8.b) TYGS

TYGS (TYpe strain Genome Server)7 is an automated high-throughput platform for genome-based taxonomy; it is a web server. It has been developed to perform prokaryotic taxonomy analyses based on the whole genome of type species strains, so it is closely related to the LPSN. By means of this web-server you can calculate the dDDH (digital DNA-DNA hybridization) values for your genomes of interest by comparing them with the closest type strains’ genome.

The web server is very easy to use and there is also a tutorial available, so we will not go through the details. You just need to upload the fasta files of your genomes under study, and follow the developers’ instructions.

8.c) JSpecies - ANI calculation -

The online web server JSpecies8 is another useful resource to measure the probability of prokaryotic genomes to belong to the same species or not, based on the their sequences. You can calculate the ANIm and ANIb values between your genomes of interest and other genomes. We recommend searching in the website’s own database for the type strains that TYGS (section 8.b) TYGS) said were closest to yours.

The website gives you instructions to use the web-server, so we will skip the explanation of the main possibilities of the web.

8.d) Genome-to-genome distance calculator -dDDH calculation-

We have already calculated ANI values, but now it is time to obtain the percentages of digital DNA-DNA hybridization (dDDH). For that, we will use the website.

All we have to do is upload the high-quality fasta file of the genome for our strains of interest, along with the accession numbers of the genome of the closest reference strains. We can obtain the reference strains and their accession numbers from the report provided by TYGS.

The platform will send us an email with all the results: dDDH (%), model confidence interval, probability that the dDDH is greater than 70%, and distance between the strains.

9. Looking for Antibiotic Resistance Genes (ARG)

There are many programs available to look for ARG: ResFinder, PlasmidFinder,AMRFinder, PointFinder, CARD, ARG-ANNOT, etc. In this link you can find many curated, reliable databases for searching antibiotic resistance genes.

Here we will use the database ResFinder9 10

Firstly, we have to download the latest version of the ResFinder database in this way:

git clone https://bitbucket.org/genomicepidemiology/resfinder_db/

We will perform a BLAST of our genomes against ResFinder database. So we have to adapt ResFinder database to the format needed to perform BLAST locally:

#!/usr/bin/env bash
set -euo pipefail

INPUT_FASTA="/home/ana/Genomas_nanopore/resfinder_db/all.fsa" #path to the downloaded ResFinder databse. You have to look for the file named "all.fsa"

OUTPUT_DIR="/home/ana/Genomas_nanopore/resfinder_db_parablast" #ouput directory

DB_NAME="resfinder_database"#prefix of the database, change according to your interests

mkdir -p "$OUTPUT_DIR" #create the output directory

echo "......creating BLAST database from $INPUT_FASTA"

makeblastdb \
    -in "$INPUT_FASTA" \
    -dbtype nucl \ #indicate that it is a nucleotide database
    -out "$OUTPUT_DIR/$DB_NAME"

echo "......BLAST database created"
echo "......database location: $OUTPUT_DIR/$DB_NAME"

As a result, the directory refinder_db_parablast is created. It contains the following files, which are needed to run BLAST properly:

resfinder_database.ndb  resfinder_database.nin  resfinder_database.not  resfinder_database.ntf
resfinder_database.nhr  resfinder_database.njs  resfinder_database.nsq  resfinder_database.nto

Now, it is time to run BLAST againts ResFinder database. We are going to select just those hits that are similar in more than 80%.

#!/usr/bin/env bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path where fasta file of the genomes are stored

RESFINDER_DB="/home/ana/Genomas_nanopore/resfinder_db_parablast/resfinder_database" #path to the already created ResFinder BLAST-formatted database

OUTPUT_DIR="/home/ana/Genomas_nanopore/09.resfinder_results" #output directory

MIN_IDENTITY=80 #minimum identity percentage, change it according to your needs

mkdir -p "$OUTPUT_DIR" #create the output directory

# Loop over all fasta file
for f in "$INPUT_DIR"/*.fasta; do #be careful and change it according the extension of your fasta files (.fna, .fa, .fasta, ...)
    
    #extract the name of each sample
    sample=$(basename "$f" .fasta)
    output_file="$OUTPUT_DIR/blastn_${sample}.txt" #the output files will start by "blastn"

    echo "......searching ARGs with blastn vs ResFinder on sample $sample"

    blastn \
        -query "$f" \
        -db "$RESFINDER_DB" \
        -out "$output_file" \
        -outfmt "6 std qlen slen" \ #format 6 of the output +  Query sequence length +  Subject sequence length
        -culling_limit 1 \
        -perc_identity "$MIN_IDENTITY"

done

echo "......ResFinder BLAST search finished"
echo "......results written to $OUTPUT_DIR"

As a result, blastn_samplename.txt files are obtained. They contain all the hit with >80% similarity to ARG in the ResFinder database. We will have to filter these files, because there may be genomes that do not contain ARGs, and we may also have partial alignments. That is, sequences that are more than 80% similar to ARGs, but only in a very small region. We will keep those that show high similarity and high alignment coverage (>90%). Of course, you can change these parameters!

Furthermore, the following script will also create a matrix that indicates the number unique genes (if an ARG was found more than once in a bacterial genome, it will show us that ARG just one time) appeared in each genome.

#!/usr/bin/env bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/09.resfinder_results" #path to the directory where the raw results of ResFinder are stored
OUTPUT_DIR="/home/ana/Genomas_nanopore/10.resfinder_matrix" #output directory

MIN_IDENTITY=80 #minimum similarity values. Change according to your interests
MIN_COVERAGE=90 #minimum alignment coverage values. Change according to your interests

FILTERED="$OUTPUT_DIR/blast_filtered_hits.txt" #name of the file that will contain all the hits that pass the filters
MATRIX="$OUTPUT_DIR/matrix_resfinder.txt" #name of the matrix to be created

mkdir -p "$OUTPUT_DIR" #create the output directory
rm -f "$FILTERED" "$MATRIX" #remove intermediate files

echo "......processing BLAST results"

awk -F'\t' \ #file is separated by tabs
    -v id="$MIN_IDENTITY" \ #passes the variable id to awk
    -v cov="$MIN_COVERAGE" \
    -v filtered="$FILTERED" -v matrix="$MATRIX" '
    
BEGIN { FS="\t" }

# Function to extract the name of the samples
function sample_name(fpath){
    gsub(".*/","",fpath) #removes all the path and keeps just the name of the sample
    gsub("blastn_","") #removes the prefix. Be careful with the structure of the name of your files
    gsub(".txt","") #removes the extension of the files
    return fpath
}

{
    # to ignore empty files (no ARGs in the genome)
    if(NF==0) next #skipt empty rows

    sample = sample_name(FILENAME) #obtains the name of the corresponding sample
    samples[sample]=1 #indicates that the sample exists

    identity=$3 #takes the column 3 of the BLAST file
    align_len=$4 #takes the column 4
    gene_len=$14 #takes the column 14
    coverage=100*align_len/gene_len #calculates the alignment coberage

    #loop over hits passing both filters
    if(identity >= id && coverage >= cov){
        gene=$2 #takes the name of the gene
        genes[gene]=1 #save the gene
        count[gene,sample]++ #counts the number of times that gene is found 
        print sample "\t" $0 >> filtered
    }
}

END {
    # if no hits pass the filters
    if(length(genes)==0){
        print "No hits passed the filters." > matrix
        exit
    }

    # creates the list of samples
    ns=0
    for(s in samples){ sample_list[ns]=s; ns++ }

    # creates the list of genes
    ng=0
    for(g in genes){ gene_list[ng]=g; ng++ }

    # prints header
    printf("\t") > matrix
    for(i=0;i<ns;i++){ printf("%s\t", sample_list[i]) >> matrix }
    printf("\n") >> matrix

    # prints the matrix
    for(i=0;i<ng;i++){
        g=gene_list[i]
        printf("%s", g) >> matrix
        for(j=0;j<ns;j++){
            s=sample_list[j]
            v=count[g,s]
            if(v=="") v=0
            printf("\t%s", v) >> matrix
        }
        printf("\n") >> matrix
    }
}
' "$INPUT_DIR"/blastn_*.txt

echo "......matrix written to $MATRIX"
echo "......filtered hits written to $FILTERED"

In case of ARG detection, two different files are created for each genome: blast_filtered_hits.txt, containing all the results of the filtered BLAST, and matrix_resfinder.txt, a matrix indicating the presence or absence of ARG in each bacterial genome.

10. Plasmid detection

In this case, there are also many software to detect plasmid in our contigs. For example, cBar, plasmidSPAdes, Plasmid Profiler, Recycler, PlasmidSeeker, PlaScope, PlasFlow, PlasmidTron, Platon, PlasmidFInder, genomad, among many others. In this tutorial, we will use the tool Platon11, because of its good results and popularity. To run this software, first we need to download the corresponding database on which it is based.

wget https://zenodo.org/record/4066768/files/db.tar.gz
tar -xzf db.tar.gz #decompress it
rm db.tar.gz #remove the compressed one to save disk space

Write down the path where the database is stored in your machine.

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="nanopore" #name of the environment where Platon is installed

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory where fasta files of the genomes are stored

OUTPUT_DIR="/home/ana/Genomas_nanopore/11.platon_results" #output directory

PLATON_DB="/home/ana/Genomas_nanopore/platon_database/" #path to the Platon database. Change it accordingly

THREADS=24

# Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the output directory

echo "Procesando archivos FASTA en $INPUT_DIR..."

# Loop over fasta files
for i in "$INPUT_DIR"/*.fasta; do #be careful and change here according to your fasta files' extension
    
    # Skipt this step if there are no fasta files
    [ -e "$i" ] || continue

    # Extract the name of the samples without the extension. Change it if your files have another extension
    base=$(basename "$i" .fasta)

    echo "Procesando muestra: $base"

    # Run Platon
    platon \
        --db "$PLATON_DB" \ #database
        --output "$OUTPUT_DIR/$base" \
        --threads "$THREADS" \
        "$i"
done

echo "......Platon finishes. Results stored in $OUTPUT_DIR"

As a result, a directory is created for each genome. For those bacteria that contain plasmids, in this directory you can find this type of files: samplename_chromosome.fasta (a fasta file of the chromosome), samplename_assembly.log, samplename.json, samplename.plasmid.fasta (a fasta file of the contigs catalogued as plasmids or with a plasmidic origen), andsamplename.tsv. The latter includes a summary of the analysis. There, you can find information regarding each contigs, its length, coverage, number of ORFs, if it is circular or not, among others.

For those bacteria that no plasmids were detected, you will just find a logfile inside the output directory.

11. Detection of integrons

The tool Integron Finder12 detects integrons in DNA sequences. It can be run in the web server Galaxy Pasteur or by command lines. We will use the latter option.

In this case, we will run several jobs in parallel:

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="integronfinder" #indicate the name of the conda environment where IntegronFinder is placed

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory containing the genomes in fasta format

OUTPUT_DIR="/home/ana/Genomas_nanopore/12.integronfinder_results" #output directory

JOBS=22 #number of jobs to run in parallel. Change it according to the power of your machine

CPUS_PER_JOB=1 #number of CPUs to be used

# Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" # create the output directory

FILES=("$INPUT_DIR"/*.fasta) #create a list containing the name of all the samples to be processed. Be careful with the extension of fasta files, and change it accordingly.

# Run IntegronFinder in parallel
printf "%s\n" "${FILES[@]}" | parallel -j "$JOBS" integron_finder \
    --cpu "$CPUS_PER_JOB" \
    --pdf \
    --outdir "$OUTPUT_DIR" \
    {}

echo "......Work finished. Results are stored in $OUTPUT_DIR"

As a result, one folder per genome is created. Inside them, we will find several files, namele samplename.integrons (file with all integrons and their elements detected in all sequences in the input file) integron_finder.out (similar to a logfile), and samplename.summary. The latter give us the number and types of integrons found in our genomes of interests.

If you find integrons, maybe it would be a nice idea to look in which contigs they are placed, and if they are in plasmids or not.

12. Detection of viruses or prophagues

There are many programs designed to detect viruses or prophages inserted into the genome of our bacteria, such us Phirbo, HostPhinder, VirHostMatcher, WIsH, Bacteriophage-HostPrediction, Host Taxon Predictor (HTP), Prokaryotic virus Host Predictor (PHP), PredPHI, PHERI, VirHostMatcher-Net, VirFinder, PHASTEST, among many others 13 14.

In this pipeline, we will use the tool geNomad15. This tool is really powerful, since it can give us a detailed report of all the potential markers from viral origin in our bacteria’s genome. It is also able to detect plasmids, and classify taxonomically all the potential viruses detected in the genomes.

Firstly, we have to download the database on which the program is based:

genomad download-database . #The "." is not a spelling mistake, is just to indicate the path where the database should be downloaded.

Then, we have to run these lines that include all the steps of the whole pipeline proposed by the developers:

#!/usr/bin/env bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the folder where our genomes of interest are located
OUTPUT_DIR="/home/ana/Genomas_nanopore/13.genomad_results" #output directory
DB="/home/ana/Genomas_nanopore/genomad_db" #path to the geNomad databse

THREADS=64

mkdir -p "$OUTPUT_DIR" #create the output directory

CONDA_ENV="genomad" #indicate the name of the conda environment where geNomad is already installed

# Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

#Loop over all the fasta files 
for fasta in "$INPUT_DIR"/*.fasta; do #be careful with the extension of fasta files, change it accordingly
base=$(basename "$fasta" .fasta) #extract the name of each sample
outdir="$OUTPUT_DIR/${base}_genomad" #the name of the output directory for each sample

echo "========================================"
echo "Processing $base"
echo "========================================"

#Pipeline
    # 1. Annotate
    genomad annotate "$fasta" "$outdir" "$DB" --threads $THREADS
    # 2. Find proviruses
    genomad find-proviruses "$fasta" "$outdir" "$DB"
    # 3. Marker classification
    genomad marker-classification "$fasta" "$outdir" "$DB"
    # 4. NN classification
    genomad nn-classification "$fasta" "$outdir"
    # 5. Aggregated classification
    genomad aggregated-classification "$fasta" "$outdir"
    # 6. Score calibration
    genomad score-calibration "$fasta" "$outdir"
    # 7. Summary
    genomad summary "$fasta" "$outdir"

done

We will obtain a directory named samplename_genomad for each sample. Inside, we will find all these files and directories:

samplename_aggregated_classification      samplename_marker_classification.log
samplename_aggregated_classification.log  samplename_nn_classification
samplename_annotate                       samplename_nn_classification.log
samplename_annotate.log                   samplename_score_calibration
samplename_find_proviruses                samplename_score_calibration.log
samplename_find_proviruses.log            samplename_summary
samplename_marker_classification          samplename_summary.log

We strongly recommend that you visit the geNomad website to find out all the details about the results obtained.

In turn, inside the directory samplename_summarywe can find the following files:

samplename_plasmid.fna           samplename_plasmid_summary.tsv  samplename_virus_genes.tsv
samplename_plasmid_genes.tsv     samplename_summary.json         samplename_virus_proteins.faa
samplename_plasmid_proteins.faa  samplename_virus.fna            samplename_virus_summary.tsv

As you can deduce, there you have the fasta files of the potential plasmids, viruses, and also the fasta files of the predicted viral proteins.

-The file samplename_virus_genes.tsv contains all the information regarding the predicted viral regions in the genome under study. For instance, it contains the name of each detected gene, the strand, the ribosome binding motif, the corresponding viral marker, e-value, the name of the assigned taxon, among other data.

-samplename_plasmid_summary.tsv is very similar, but it is related to potential plasmids found in the genome of interest. You can check if you get the same results with this tool and with Platon.

-samplename_virus_summary.tsv is one of the most useful files. It is a very detailed list of all proviruses detected in the genome, ant their main characteristics. Please, check the developers’ website to go into more details.

13. Detection of virulence factors

There is a curated database that contains information about virulence factor many different bacterial pathogens, which is named Virulence Factor Database (VFDB)16. We are going to dowload it and perform BLAST of our bacterial genomes’ against VFDB.

So let’s download the database firstly.

Note

VFDB contains two type of nucleotide datasets. One of them is called by the developers “core dataset” (setA), and it just included representative genes associated with experimentally verified Virulence Factors. The other onde, “full dataset” (setB) covers all genes related to already known and predicted VFs.

You can find both of them in the VFDB website. But we will be restrictive in this tutorial and will use the setA (validated VFs genes)

Thus:

wget https://www.mgc.ac.cn/VFs/Down/VFDB_setA_nt.fas.gz
gzip -d the_data_base.fas.gz #decompress the downloaded file

Look at the format of the VFs name in the database:

>VFG037176(gb|WP_001081735) (plc1) phospholipase C [Phospholipase C (VF0470) - Exotoxin (VFC0235)] [Acinetobacter baumannii ACICU]
ATGAATCGTCGCGAATTTCTTTTAAATTCTACAAAAACAATGTTTGGGACAGCTGCTCTA
GCGAGTTTCCCGCTGAGTATTCAAAAAGCGTTAGCAATTGACGCCAAAGTTGAAAGTGGA
ACAATTCAAGATGTTAAACACATTGTGATTTTGACTCAGGAAAACCGTTCATTTGATA

As you can see, there are free spaces separating the words. By default, BLAST truncates query sequence names when it encounters a blank space, and deletes the rest of the sequence name, so we must adapt all the names of the VFs in the database. Let’s replace all the blank spaces by “_”

#you should be in directory where the database is placed. In this example "/home/ana/Genomas_nanopore/"
sed -i '/^>/ s/ /_/g' VFDB_setA_nt.fas #indicate the name of your database, here is "VFDB_setA_nt.fas"

Let’s a look to the output:

head -n 2 VFDB_setA_nt.fas
>VFG037176(gb|WP_001081735)_(plc1)_phospholipase_C_[Phospholipase_C_(VF0470)_-_Exotoxin_(VFC0235)]_[Acinetobacter_baumannii_ACICU]
ATGAATCGTCGCGAATTTCTTTTAAATTCTACAAAAACAATGTTTGGGACAGCTGCTCTA

Now, the names of the VFs’ sequences are well formatted. To look for VFs in our bacterial genomes, then we will perform a BLAST search. So it is time to adapt this database to the BLAST format, according to these command lines:

#!/usr/bin/env bash
set -euo pipefail

INPUT_FASTA="/home/ana/Genomas_nanopore/VFDB_setA_nt.fas" #path to the directory where the genomes are stored

OUTPUT_DIR="/home/ana/Genomas_nanopore/VFDB_parablast" #output directory

DB_NAME="VFDB_setA_nt" #prefix of the database

mkdir -p "$OUTPUT_DIR" #create output directory

makeblastdb \
    -in "$INPUT_FASTA" \
    -dbtype nucl \ #indicate that we work with DNA sequences
    -out "$OUTPUT_DIR/$DB_NAME"

echo "......Database created"
echo "Location: $OUTPUT_DIR/$DB_NAME"

In this example, these lines create the directory VFDB_parablast, which contains these files:

VFDB_setA_nt.ndb  VFDB_setA_nt.nin  VFDB_setA_nt.not  VFDB_setA_nt.ntf
VFDB_setA_nt.nhr  VFDB_setA_nt.njs  VFDB_setA_nt.nsq  VFDB_setA_nt.nto #prefix + different extension

Now, we are ready to run BLAST of our bacterial genomes against VF’s database:

#!/usr/bin/env bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #directory in which fasta files are located

VFDB_DB="/home/ana/Genomas_nanopore/VFDB_parablast/VFDB_setA_nt" #path and prefix of the VF database adapted to run with BLAST

OUTPUT_DIR="/home/ana/Genomas_nanopore/14.VF_blast_results" #output directory

MIN_IDENTITY=80 #minimun similarity level. Change it according to your needs

mkdir -p "$OUTPUT_DIR" #create output directory

# Loop over all fasta files
for fasta in "$INPUT_DIR"/*.fasta; do #be careful and check whether fasta files have the extension ".fasta". Otherwise, change it accordingly
    
    # Extract the names of the sample
    sample=$(basename "$fasta" .fasta)

    echo "--- searching Virulence Factors with blastn vs VFDB on sample $sample"

    blastn \
        -query "$fasta" \
        -db "$VFDB_DB" \
        -out "$OUTPUT_DIR/VF_${sample}.txt" \
        -outfmt "6 std qlen slen" \ #BLAST output 6 format +  Query sequence length +  Subject sequence length
        -culling_limit 1 \
        -perc_identity "$MIN_IDENTITY"

done

echo "......BLAST search against VFDB finished"
echo "......results written to $OUTPUT_DIR"

If you want the change BLAST parameters, you can more information about it here.

We want to be restrictive, so we will filter the results and recover just those hits that are similar to our bacterial genes in > 80%, and the alignment coverage have to be also > 90% of the subject length:

#!/usr/bin/env bash
#This script is very similar to that of ARG detection, so see section #9 to understan each command line
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/14.VF_blast_results"

OUTPUT_DIR="/home/ana/Genomas_nanopore/15.VF_filtered"

MIN_IDENTITY=80
MIN_COVERAGE=90

FILTERED="$OUTPUT_DIR/blast_filtered_hits.txt"
MATRIX="$OUTPUT_DIR/matrix_filtered_VF.txt"

mkdir -p "$OUTPUT_DIR"
rm -f "$FILTERED" "$MATRIX"

echo "......processing BLAST results"

awk -F'\t' \
-v id="$MIN_IDENTITY" \
-v cov="$MIN_COVERAGE" \
-v filtered="$FILTERED" \
-v matrix="$MATRIX" '

BEGIN{
FS="\t"
}

function sample_name(file){
    gsub(".*/","",file)
    gsub("VF_","",file)
    gsub(".txt","",file)
    return file
}

{

if(NF==0) next

sample=sample_name(FILENAME)
samples[sample]=1

identity=$3
align_len=$4
gene_len=$14

coverage=100*align_len/gene_len

if(identity>=id && coverage>=cov){

gene=$2

genes[gene]=1
count[gene,sample]++

print sample "\t" $0 >> filtered

}

}

END{

if(length(genes)==0){
print "No virulence factors passed the filters." > matrix
exit
}

ns=0
for(s in samples){
sample_list[ns]=s
ns++
}

ng=0
for(g in genes){
gene_list[ng]=g
ng++
}

printf("\t") > matrix
for(i=0;i<ns;i++){
printf("%s\t",sample_list[i]) >> matrix
}
printf("\n") >> matrix

for(i=0;i<ng;i++){

g=gene_list[i]

printf("%s",g) >> matrix

for(j=0;j<ns;j++){

s=sample_list[j]

v=count[g,s]
if(v=="") v=0

printf("\t%s",v) >> matrix

}

printf("\n") >> matrix

}

}

' "$INPUT_DIR"/VF_*.txt

echo "......matrix written to $MATRIX"
echo "......filtered hits written to $FILTERED"

In case of VF detection, two different files are created: blast_filtered_hits.txt, containing all the results of the filtered BLAST, and matrix_filtered_VF.txt, a matrix indicating the presence or absence of VFs in each bacterial genome.

14. Functional annotation

There are several valid ways to assign a functional annotation to all sequences of our genomes of interest. In this tutorial, we will describe two of the most popular ones, based on the tools Bakta and eggNOGmapper.

14.a) Functional annotation with Bakta

Bakta17 is a powerful tool for the annotation of bacterial genomes and plasmdis. There is a lot of documentation available is this website.

Firstly, we have to download the latest version of Bakta database and decompress it:

bakta_db download --type full --output full_db #you can also use 'wget'
mkdir bakta_database
tar -xf db.tar.xz -C bakta_database
rm db.tar.xz #remove the compressed database to save disk space.
Note

Sometimes the AMRFinder database itself causes problems, so it is advisable to update it in this way in case of having problems with it:

amrfinder_update --force_update   --database /home/ana/Genomas_nanopore/bakta_database/db/amrfinderplus-db

Although it may seem strange, the AMRFinder database has to be inside the own Bakta database directory.

Let’s run Bakta inside a loop and in parallel:

#!/usr/bin/env bash
set -euo pipefail

CONDA_ENV="bakta" #indicate the name of the environment where Bakta is properly installed

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory where fasta files are located

BAKTA_DB="/home/ana/Genomas_nanopore/bakta_database/db" #path to the Bakta database

OUTPUT_DIR="/home/ana/Genomas_nanopore/16.bakta_results" #output directory

JOBS=3 #number of jobs to be run in parallel. Change it according to your server

#Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "$OUTPUT_DIR" #create the output directory

FILES=("$INPUT_DIR"/*.fasta) #fasta files and their extension. Be careful and change this part according to the extension of your fasta files

#Run Bakta in parallel for all the files in the input directory
time printf "%s\n" "${FILES[@]}" | parallel -j "$JOBS" '
    fasta={}
    sample=$(basename "$fasta" .fasta)

    echo "Processing sample: $sample"

    bakta \
        --db "'"$BAKTA_DB"'" \
        --force \
        --output "'"$OUTPUT_DIR"'/${sample}_bakta" \
        "$fasta"
'

echo "......Annotation already finished"
echo "......Results saved in $OUTPUT_DIR"

These commands generate a directory for each analyzed genome, where you can find all these files:

samplename.embl  samplename.gff3               samplename.log
samplename.faa   samplename.hypotheticals.faa  samplename.png
samplename.ffn   samplename.hypotheticals.tsv  samplename.svg
samplename.fna   samplename.inference.tsv      samplename.tsv
samplename.gbff  samplename.json               samplename.txt

We will focus in these files:

-samplename.txt: this file can help us to understand the overall landscape of the genomes under study, since it give us information about the contigs’ length, the number of tRNAs, rmRNAs, rRNAs, ncdRNAS, CRISPR arrays, among other data.

-samplename.tsv: it includes information about the type of all annotated loci (type: rRNA, tRNA, CDS, ncRNA, etc.), the coordinates, the strand, the name and the product of the gene, among others.

As you can see in the output, this software can give us the map of each genome in PNG and SVG files.

14.b) Functional annotation with eggNOG-mapper

Another useful, powerful for genome annotation is the program eggNOG-mapper18, also known as emapper. It uses precomputed orthologous groups (OGs) and phylogenies from the eggNOG database19 to transfer functional information from fine-grained orthologs only, so firstly we have to download the database:

wget -r http://eggnog5.embl.de/download/emapperdb-5.0.2/ #-r because there are many directories inside, and we want to download all of them
cd /home/ana/Genomas_nanopore/eggnog5.embl.de/download/eggnog_5.0/ 
gunzip *.gz #decompress the file in .gz extension
tar -xzvf *.tar.gz #decompress all the files in .tar.gz extension

We can now run these commands to annotate our genomes of interest:

#!/usr/bin/env bash
set -euo pipefail

GENOMES_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory where the fasta files are stored
DB_DIR="/home/ana/Genomas_nanopore/eggnog5.embl.de/download/emapperdb-5.0.2/" #path to the eggnog database
OUT_DIR="/home/ana/Genomas_nanopore/17.eggnogmapper_results" #output directory

THR=48

CONDA_ENV="nanopore" #name of the environment where emapper.py file is located

#Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

mkdir -p "${OUT_DIR}" #create ouput directory

#Loop over fasta files
for GENOME in "${GENOMES_DIR}"/*.fa "${GENOMAS_DIR}"/*.fna "${GENOMES_DIR}"/*.fasta; do #it works well for different fasta file formats
    [ -e "$GENOME" ] || continue

    NAME=$(basename "$GENOME")
    PREFIX=${NAME%.*}

    emapper.py \
        -i "$GENOME" \
        -o "$PREFIX" \
        --output_dir "$OUT_DIR" \
        --itype genome \ #type of data input. Be careful because "proteins" is by default
        --translate \ #translate predicted CDS to proteins
        --genepred prodigal \ #method to perform gene prediction (more opt: DIAMOND, MMseqs2)
        --cpu "$THR" \
        -m diamond \ #search seed orthologs (more opt: mmseqs, hhmer,..)
        --data_dir "$DB_DIR"

done

echo "......Annotation already finished"
echo "......Results saved in $OUTPUT_DIR"

EggNOG-mapper gives us different files for each genome:

samplename.emapper.annotations
samplename.emapper.genepred.fasta
samplename.emapper.genepred.gff
samplename.emapper.hits
samplename.emapper.seed_orthologs

We will focus on some of the in this tutorial:

-samplename.genepred.fasta: this file includes the sequences of predicted CDS (just if the options genome or metagenome were selected for itype flag).

-samplename.emapper.annotations: this file is really useful since each row represent the annotation for a given query. There ar different columns indicating the ortholog, e-value, score, COG categories, Description of the predicted function, associated EC, KEGG identifiers, CAZys, among others.

15. Detection of secretion systems

Some of VFs detected in the section 13. Detection of virulence factors are functionally classified as “Effector delivery system”. Secretion systems are usually composed by different proteins, so if we want to know if all the genes needed to code all the elements of a secretion system are in a our genomes of interest, we can use the models of TXSScan20, integrated in the tool MacSyFinder21.

After the installation of MacSyFinder, we need to install the models, since this software is based on Hidden Markov Models (HMM). For that end, you have to run this command:

msf_data install --user TXSScan

Once the models are installed, you just have to run the following lines. In this case, the software works with the sequences of the predicted CDS. You can use the annotations made by Bakta or eggNOG-mapper (or whichever software you use for functional predictions). In this tutorial, we will use the results given by eggNOG-mapper.

#!/bin/bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/17.eggnogmapper_results" #path to the directory where the predicted CDS in fasta file format are stored.

OUTPUT_DIR="/home/ana/Genomas_nanopore/18.TXSScan_results" #output directory

CPU=64

CONDA_ENV="nanopore" #indicate the name of the environment where macsyfinder is installed

mkdir -p "$OUTPUT_DIR" #create output directory

#Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

# Loop over all fasta files
find "$INPUT_DIR" -type f -name "*.fasta" | while read fasta_file; do #be careful and take into account the extension of the fasta files (Bakta gives .faa extension while emapper gives .fasta files)

    # Extract the name of the files, whithout the extension. Change the extension accordingto your files
    base_name=$(basename "$fasta_file" .fasta)
    
    # Create a directory for each genome
    out_dir="$OUTPUT_DIR/${base_name}_TXSScan"
    mkdir -p "$out_dir"
    
    echo "Running TXSScan over $fasta_file ..."
    
    # Execute MacSyFinder / TXSScan
    macsyfinder --sequence-db "$fasta_file" \ #Path to the sequence dataset in fasta format
                --models TXSScan all \ #the models to search. Select among "TXSS Flagellum T2SS", "CRISPRcas/subtyping all" (model described for CRISPERcas subfamilies), and "TXSS all" (all available models)
                --db-type ordered_replicon \ #type of dataset. If you are working with assembled genomes select "ordered_replicon", "unordered" for non-assembled genomes, and "gembase" for sets of replicons following a specific structure (see user guide)
                -o "$out_dir" \
                -w "$CPU"
    
    echo "Finishing $fasta_file -> Results stored in $out_dir"
done

echo "TXSScan finished for all fasta files"

A new folder will be created for each genome, inside which you find these files:

all_best_solutions.tsv  all_systems.txt           best_solution_multisystems.tsv  best_solution.tsv  macsyfinder.conf  rejected_candidates.tsv
all_systems.tsv         best_solution_loners.tsv  best_solution_summary.tsv       hmmer_results      macsyfinder.log   rejected_candidates.txt

We suggest you to have a look at the user guide to better understand all these files and hmmer_results directory.

The file best_solution_summary.tsv is the one that tells us the total number of secretion systems detected in each genome under study, while best_solution.tsv includes many details about those secretion systems with the higher score. The latter includes the name of the replicons, the name of the detected gene, loci, wholeness of the secretion system, coverage, among many other details.

16. Detection of genes involved in secondary metabolite production

Secondary metabolites could be very important in the survival and general fitness of plant-associated bacteria. So, we will use the tool antiSMASH22 to detect clusters of co-occurring biosynthesis genes in genomes. They are known as Biosynthetic Gene Clusters (BGCs).

First, we have to download the antiSMASH database:

download-antismash-databases

Then, we have just to run these lines:

#!/bin/bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory containing all the assembled genomes
OUTPUT_DIR="/home/ana/Genomas_nanopore/19.antismash_results" #output directory

CPU=64

mkdir -p "$OUTPUT_DIR" #create the output directory

CONDA_ENV="antismash8" #indicate the name of the environment where atniSMASH is installed

#Activate conda environment
source "$(conda info --base)/etc/profile.d/conda.sh"
conda activate "$CONDA_ENV"

#Loop over all fasta files
for genome in "$INPUT_DIR"/*.fasta; do #be careful here, change it according to your fasta files' extension
    base=$(basename "$genome")
    sample=${base%%.*} #extract the name of the samples without the extension

    echo ">>> Processing sample: $sample"

    antismash \
        "$genome" \
        --output-dir "$OUTPUT_DIR/$sample" \
        --output-basename "$sample" \ #similar to a prefix for each sample name
        --taxon bacteria \ #you can choose between bacteria and fungi (synonymous: -t)
        --cpus $CPU" \
        --genefinding-tool prodigal \ #algorithm for gene finding. Options: prodigal (Prodigal), prodigal-m (Prodigal Metagenomic/Anonymous mode), none
        --cb-knownclusters \ #Compare identified clusters against known gene clusters from the MIBiG database
        --cb-subclusters \ #Compare identified clusters against known subclusters responsible for synthesising precursors
        --asf \ #Run active site finder analysis
        --pfam2go #Run Pfam to Gene Ontology mapping module
done

echo ">>> All the analyses performed"

antiSMASH program includes a lot of possibilities, so we encourage the user to inspect carefully the user manual.

The previous command lines create a directory for each genome under study. In each folder you can find many files and the index.html file. It will open an interactive website where you can find all the regions (you can find the definition of this concept here). If you click on each region, you will see the loci that compose it, the coordinates, the potential product and its function, even the similarity confidence and the most similar known cluster. There are many different possibilities you can explore!

17. Annotation of CAZymes

It is possible to determine where our bacteria of interest contain genes involved in the CAZyme biosynthesis, as well as CAZyme Gene Clusters (CGC). To annotate these enzymes, we can use the tool dbCAN23 and the corresponding database this program is based on.

Firstly, we have to download the database of dbCAN. Let’s create a new directory to host it:

mkdir dbCAN_db
cd dbCAN_db

Now, download all the elements that compose the database:

{r.} wget http://dbcan-hcc.unl.edu/download/dbCAN-HMMdb-V14.txt wget http://dbcan-hcc.unl.edu/download/Databases/CAZyDB.07262023.fa wget http://dbcan-hcc.unl.edu/download/Databases/dbCAN_sub.hmm wget http://dbcan-hcc.unl.edu/download/Databases/tcdb.fa

Each element of the database has to be “formatted”, so run these lines:

hmmpress dbCAN-HMMdb-V14.txt #it creates files with the extension .h3f, .h3i, .h3m, .h3p
hmmpress dbCAN_sub.hmm #it creates a file with the extension .sub.hmm
diamond makedb --in CAZyDB.07262023.fa -d CAZy #it creates a file with the extension .dmnd
diamond makedb --in tcdb.fa -d tcdb #it creates a file with the extension .dmnd

So, we will have this files in the database directory:

CAZy.dmnd           dbCAN-HMMdb-V8.txt.h3f  dbCAN-HMMdb-V8.txt.h3m  dbcan_out      dbCAN_sub.hmm.h3f  dbCAN_sub.hmm.h3m  tcdb.dmnd
dbCAN-HMMdb-V8.txt  dbCAN-HMMdb-V8.txt.h3i  dbCAN-HMMdb-V8.txt.h3p  dbCAN_sub.hmm  dbCAN_sub.hmm.h3i  dbCAN_sub.hmm.h3p

Now, we are ready to run the command run_dbCAN

#!/bin/bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/17.eggnogmapper_results" #path to the annotation results
OUT_BASE="/home/ana/Genomas_nanopore/20.dbCAN_results" #output directory
DB_DIR="/home/ana/Genomas_nanopore/dbCAN_db" #path to the directory containing the database
DB_HMM_FILE="$DB_DIR/dbCAN-HMMdb-V14.txt" #path to the HMM dabase

DIA_CPU=64
HMM_CPU=64

CONDA_ENV="run_dbcan_env" #write the name of the environment where dbCAN is installed

mkdir -p "$OUT_BASE" #create the ouput directory

# Activate conda environment
source ~/miniconda3/etc/profile.d/conda.sh
conda activate run_dbcan_env

# Loop over all fasta files
for fasta_file in "$INPUT_DIR"/*.emapper.genepred.fasta; do #be careful and adapt this line to your fasta files name format
    #extract the name of the samples
    strain_name=$(basename "$fasta_file" .emapper.genepred.fasta)
    
    # Look for the corresponding GFF files. They are needed for CGCs prediction
    gff_file=$(find "$INPUT_DIR" -maxdepth 1 -type f -name "$strain_name*.gff" | head -n 1)
    
    #create an output directory for each genome/sample
    OUT_DIR="$OUT_BASE/$strain_name" 
    mkdir -p "$OUT_DIR"
    
    if [[ ! -f "$gff_file" ]]; then
        echo "GFF missing for $strain_name, skipping it..."
        continue
    fi
    
    echo "Processing $strain_name ..."
    
    run_dbcan "$fasta_file" protein \
        -c "$gff_file" \ #Predict CGCs via CGCFinder
        --out_dir "$OUT_DIR" \
        --db_dir "$DB_DIR" \
        --dbCANFile "$DB_HMM_FILE" \ #name of the HMM database
        --dia_cpu "$DIA_CPU" \ #number of CPU for DIAMOND
        --hmm_cpu "$HMM_CPU" \ #number of CPU for HMMER
        --cgc_sig_genes all #CGCFinder Signature Genes value (options: all; tp; tf)
    
    echo "Finalizado $strain_name"
done  # Cierre del bucle for

echo "Todos los archivos procesados."

Take into account all the potential parameters than could be changed. You can have a look at the dbCAN developers’ recommendations here.

A folder for each genome/sample will be created. Inside it, we will find this files:

cgc.gff           diamond.out  overview.txt  tf-2.out
cgc.out           eCAMI.out    stp.out       tp.out
cgc_standard.out  hmmer.out    tf-1.out      uniInput

In brief, they contain:

-uniInput: it is the file that Prodigal creates if nucleotide fastas are used.

-hmmer.out: HMMER output file.

-tf.out: DIAMOND output file, corresponding to the prediction of Transcriptional Factors.

-tc.out: the same as tf.out, but for transporter classifications.

-cgc_standard.out: a summaryzed version of cgc.out. It contains all the information referred to the CGCs (CAZyme Gene Cluster), for instance, the CGC id, type (CAZyme, TC, TF, STPS or Signal Transduction Proteins) or even null, and annotation, among others.

-overview.txt: this is the most interesting file, since it gives us a summary of all the predictions made by CGCFinder, HMMER, DIAMOND, etc. It shows us the EC Code, gene ID, etc. for each annotated gene.

It is highly recommended to visit the dbCAN website to gain more information about all the outputs and their meaning.

18. Identification of potential interactions host-pathogens

We will use the database PHI-base24 to catalogue the potential pathogenicity, virulence and effector genes of our bacteria of interest. This database is based on empirically verified data, and it can be used for different microorganisms (bacteria, fungi, oomycetes) and to search for interactions with different types of hosts (animal, plants, fungi and insects).

Although there is web-server available, we will download the corresponding database and run BLAST against it. This database contains the sequences in fasta format of different proteins related to virulence and pathogenicity. For that purpose, we will use the sequence of the proteins predicted by eggNOG-mapper, and then BLASTp to align them against the PHI-database

Let’s download the latest database:

wget https://raw.githubusercontent.com/PHI-base/data/master/releases/phi-base_current.fas

If we have a look at the download file, we can see than the name of the sequences are too long in some cases. In the following example, the name of the sequences contains 90 characters!

>A0A014N184#PHI:124318#Eng1#92637#Metarhizium_acridum#increased_virulence_(hypervirulence)
MQRYGRDDHQEREPLGGPPDYNTPPRQAGGNVYNYDYAAADSPYYDDASPPRPQDAFRMQQQHQPYQSYQSYVGHDASSAGRGYGHEAVAPAPPQHNDFTAYNRGPAQQGQDHPYAQHVAQSNITPGADNFGEHASGGMAGIAYSVADHRAHEGGMEAAGGIGQLPPPPSRSQYPNTHDAGFNNSQPGGYAPETVYNRGPGQHQLPAQGSGSSLNPFNTPSATHSPTRSLRSFGGESFGDEPYQAMPTN

BLAST does not work well with so long sequence names (longer than 50 characters), so we have to shorten them:

#!/bin/bash
set -euo pipefail

PHI_FAA="/home/ana/Genomas_nanopore/PHI-base_basedatos.txt" #path to the already dowloaded PHI-database

PHI_FAA_SHORT="/home/ana/Genomas_nanopore/PHI-base_proteins_short.faa" #path and name of the modified PHI-database

# Shorten the heades (just the first word until it finds the first blank space) 
awk '/^>/ {print ">" substr($1, 2, 50); next} {print}' "$PHI_FAA" > "$PHI_FAA_SHORT" #you can adapt the length of the header

echo "Headers modified to 50 characters"
echo "Modified PHI-database ready to use with BLAST: $PHI_FAA_SHORT"

As we performed before, we have to adapt the modified database to BLAST-format. Run these commands:

#!/usr/bin/env bash
set -euo pipefail

PHI_FASTA="/home/ana/Genomas_nanopore/PHI-base_proteins_short.faa" #path to the modified version of the PHI-database

DB_DIR="/home/ana/Genomas_nanopore/PHI_db_parablast" #path to the directory where the BLAST-adapted database will be stored

DB_NAME="PHI_db" #prefix of the BLAST-database

mkdir -p "$DB_DIR" #create the directory

makeblastdb \
    -in "$PHI_FASTA" \
    -dbtype prot \ #be careful! Now we are working with proteins
    -out "$DB_DIR/$DB_NAME" \
    -parse_seqids

echo "......BLAST database already cread"
echo "......It is stored in: $DB_DIR/$DB_NAME"

Now, let’s run BLASTp. In this case, we have included the filtering step of BLASTp outputs (remove all hits < 80% similarity and < 80% alignment coverage).

#!/bin/bash
set -euo pipefail

INPUT_DIR="/home/ana/Genomas_nanopore/17.eggnogmapper_results"#path to the directory that contains the annotations made by eggNOG-mapper

PHI_DB="/home/ana/Genomas_nanopore/PHI_db_parablast/PHI_db" #path to PHI database

OUT_DIR="/home/ana/Genomas_nanopore/21.PHI_results" #output directory

mkdir -p "$OUT_DIR" #create output directory

THREADS=64
OUTFMT="6 std qlen slen" #BLAST output format
CULLING_LIMIT=1

#Look for all .fasta files
find "$INPUT_DIR" -type f -name "*.fasta" | while read fasta_file; do

    # Extract de directory containing the genomes to get all the sample's name
    sample=$(basename "$fasta_file" .fasta)    
    # Output files'name
    out_file="$OUT_DIR/${sample}_vs_PHI.out"
    filtered_out="$OUT_DIR/${sample}_vs_PHI.filtered.out"
    
    echo "Processing $sample"
    
    # BLASTP
    blastp -query "$fasta_file" \
           -db "$PHI_DB" \
           -out "$out_file" \
           -outfmt "$OUTFMT" \
           -culling_limit "$CULLING_LIMIT" \
           -num_threads "$THREADS"

 # Filter the hits (>80% similarity and >80% alignment coverage)
   awk '{cov=$4/$14; if($3>=80 && cov>=0.9) print}' "$out_file" > "$filtered_out" #change this parameters according to you interests
    
    echo "Redy: $sample"
done

echo "All BLASTp finished."

As a result, we can find two files:

-samplename.out: it contains all the results obtained by BLASTp.

-samplename.filtered.out: it just contains the results of the BLASTp filtering. That is, just those hits that pass the cut-off of similarity and coverage. The format of the results fits BLAST standard 6 format, including also the length of the query and subject sequences.

But remember that we shortened the name of the sequences in the PHI-database, and we need the keep the original name. So, let’s recover the full name of the sequences in the PHI-database. Run these line to recover the original names:

#!/bin/bash
set -euo pipefail

PHI_FULL="/home/ana/Genomas_nanopore/PHI-base_basedatos.txt" #path to the original PHI-database

PHI_SHORT="/home/ana/Genomas_nanopore/PHI-base_proteins_short.faa" #path to the modified PHI-database

RESULTS_DIR="/home/ana/Genomas_nanopore/21.PHI_results" #path to BLASTp results

MAP_FILE="phi_id_mapping.tsv"

# Extracts full headers
grep "^>" "$PHI_FULL" | sed 's/^>//' > full_headers.tmp

# Extracts modified headers
grep "^>" "$PHI_SHORT" | sed 's/^>//' > short_headers.tmp

# Creates a map that matches modified-hull headers
paste short_headers.tmp full_headers.tmp > "$MAP_FILE"

rm full_headers.tmp short_headers.tmp

echo "Processing filtered files..."

#Loop over all the filtered files
for file in "$RESULTS_DIR"/*.filtered.out; do
    
    output_file="${file%.filtered.out}.annotated.tsv" #creates a file that contains all the filtered results with the full headers
    
    awk -F'\t' 'BEGIN{
        OFS="\t"
        while((getline < "'$MAP_FILE'")>0){
            split($0,a,"\t")
            map[a[1]]=a[2]
        }
    }
    {
        full_name = ($2 in map) ? map[$2] : "NA"
        print $0, full_name
    }' "$file" > "$output_file"
    
done

echo "Process finished."

These script generated one new file for each genome under study, namely samplename.annotated.tsv. This file contains all the results of BLASTp filtered according to specified cut-offs of similarity and coverage, and one column indicating the full name of each hit.

Warning

Be careful. The first column of samplename.annotated.tsv still contains the truncated sequence names of the hits. Do not pannic, you can find the original names in the last column.

To better undertand the hits you obtain, it is highly recommended to visit the PHI-database website, specially the section entitled “Search”.

19. Detection of PGPR traits

Most plant-associated bacteria are able to fix atmospheric N2, solubilize minerals, produce siderophores, among many other plant-beneficial capabilities. Hence, they are usually called Plant Growth Promoting (Rhizo)Bacteria (PGPR or PGPB)25.To study genes potentially involved in this activities, we will use a website to perform this analysis, namely [PLant-associated BActeria web resource (PLaBAse) web] (https://plabase.cs.uni-tuebingen.de/pb/plabase.php).

There are two services that stand out: PIFAR-Pred and PGPT-Pred. The former one is very useful to annotate just plant bacterial interaction factors, by using BLASTp+HMMER against a database. The latter is aimed at annotating bacterial plant growth-promoting proteins.

In both cases, it is necessary to upload the predicted sequence of the proteins in fasta format.

The website is very well documented, so you can follow easily their user manual.

In both cases you will obtain a pie chart indicating the percentaje of each annotated category, also a Krona chart, and all the annotation results in a .txt file.

20. Detection of repeated DNA sequences

If you want to screen DNA sequences for interspersed repeats, and low complexity DNA sequences you should use these programs: RepeatModeler26 and RepeatMasker27.

20.a) RepeatModeler

RepeatModeler assists in automating the runs of the various algorithms given a genomic database, clustering redundant results, refining and classifying the families and producing a high quality library of TE (Transposable Elements) families suitable for use with RepeatMasker. This program needs to create a database firstly (similar to that we made to perform BLAST searches). Then, we just have to run RepeatModeler. We have developed these line to run the program:

#!/bin/bash
set -euo pipefail

GENOME_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #path to the directory where fasta files of the genomes are stored.

OUTPUT_DIR="/home/ana/Genomas_nanopore/22.RepeatModeler_results" #output directory

CPU=64 #change according to your server
CONDA_ENV= "repeatmodeler" #indicate the name of the environment where RepeatModeler is installed

mkdir -p "$OUTPUT_DIR" #create output directory

#activate conda environment
source ~/miniconda3/etc/profile.d/conda.sh
conda activate $CONDA_ENV

# Loop over all the genomes included in the input directory 
find "$GENOME_DIR" -type f \( -name "*.fasta" -o -name "*.fa" -o -name "*.fna" \) | while read fasta_file; do #finding fasta files regardless their extension

    # Extract the base name of the samples
    base_name=$(basename "$fasta_file")
    base_name=${base_name%%.*}  # remove the extension

    # Create a specific directory to save each result
    out_dir="$OUTPUT_DIR/${base_name}_RepeatModeler"
    mkdir -p "$out_dir"

    echo "Processing $fasta_file ..."

    # Construct the database for RepeatModeler. Is similar to a wrapper around BLAST database creation script
    BuildDatabase -name "$base_name" "$fasta_file" -engine ncbi
    #-name: the name of the database to create
    #-engine: the name of the search engine we are using
    

    # Run RepeatModeler
    RepeatModeler -database "$base_name" -pa "$CPU" #the database we have just created

    # Move the results to the output directory
    mv "$base_name"* "$out_dir"/ 2>/dev/null || true

    echo "Finished: $fasta_file -> results in $out_dir"
done

echo "RepeatModeler completed for all genomes under study"

After running this script, we obtain one directory for each genome studied. In this folder, we can see all these files:

samplename-families.fa
samplename-families.stk
samplename.nhr
samplename.nin
samplename.nnd
samplename.nni
samplename.nog
samplename.nsq
samplename.translation

samplename-families.fa is the file that contains all the consensus sequences in fasta file. It is useful to search in specialized libraries such by means of RepeatMasker.

Note

The script also generates temporary files containing all the information needed for debugging in case of errors. These files are stored in the working directory (that is, outside the output directory, since it had not yet been created). The directory names follow this format: RM_PID_DATE. You can remove them if you are aware the program did run well.

20.b) RepeatMasker

RepeatMasker is a popular software to identify, classify, and mask repetitive elements, including low-complexity sequences and interspersed repeats. RepeatMasker searches for repetitive sequence by aligning the input genome sequence against a library of known repeats. It replaces repeated regions by “N” (or the symbol you want). The program needs the models previously created with RepeatModeler, and the fasta files of the genomes we are analyzing.

#!/bin/bash
set -euo pipefail

GENOME_DIR="/home/ana/Genomas_nanopore/05.renamed_contigs_fasta" #input directory where fasta files of the genomes are stored
RM_DIR="/home/ana/Genomas_nanopore/22.RepeatModeler_results" #directory where RepeatModeler results are stored
OUTPUT_DIR="/home/ana/Genomas_nanopore/23.RepeatMasker_results" #putput directory

CPU=64 #change it according to your server
CONDA_ENV="repeatmodeler" #indicate the name of the conda environment where RepeatMasker is installed

mkdir -p "$OUTPUT_DIR" #create the output directory

# Activate conda environment
source ~/miniconda3/etc/profile.d/conda.sh
conda activate $CONDA_ENV

#Loop over all genomes
find "$GENOME_DIR" -type f \( -name "*.fasta" -o -name "*.fa" -o -name "*.fna" \) | while read genome; do #search fasta files regardless of their extension

    #extract the name of the samples/genomes without extension
    base=$(basename "$genome")
    base=${base%%.*}

    echo "Processing: $base"

    # Look for the corresponding directory of RepeatModeler
    RM_GENOME_DIR=$(find "$RM_DIR" -maxdepth 1 -type d -name "${base}*" | head -n 1)

    if [[ -z "$RM_GENOME_DIR" ]]; then
        echo "The directory of RepeatModeler for $base was not found"
        continue
    fi

    # Look for the library that RepeatModeler used
    LIB=$(find "$RM_GENOME_DIR" -maxdepth 1 -type f -name "*-families.fa" | head -n 1)

    if [[ -z "$LIB" ]]; then
        LIB=$(find "$RM_GENOME_DIR" -maxdepth 1 -type f -name "*-families.fa" | head -n 1)
    fi

    if [[ -z "$LIB" ]]; then
        echo "No -families.fa file was found for  $base"
        continue
    fi

    OUT_DIR="$OUTPUT_DIR/${base}_RepeatMasker" #create a directory for each genome
    mkdir -p "$OUT_DIR"

    #Run RepeatMasker:
    RepeatMasker \
        -pa "$CPU" \ #number of CPUs
        -lib "$LIB" \ #name of the library
        -gff \ #creates an additional Gene Feature Finding format output
        -x \ #returns repetitive region masked with X letter
        -excln \ #calculate repet densities
        -dir "$OUT_DIR" \
        "$genome"

    echo "Finished $base"

done

As output, we obtain one directory for each genome. Inside these folders, we can see that we have different files:

-basename.fasta.cat: this file contains the alingment of the genomes against the previously obtained models.

-basename.fasta.masked: fasta file in which the sequence of repetitive elements are masked (in this example, with “X”.)

-basename.fasta.out. This file is readable in the terminal. It shows us the best results obtained by RepeatMasker (according to the establishec cut-off, in this example it was left by default). We can see there the Smith-Waterman socre, the name of the sequences, the beggining and the end of the query, among other parameters. If you want more details about this file, have a look at this website.

-basename.fasta.out.gff: (the same in gff format).

-basename.fasta.tbl: this table is readable in the terminal. It gives us the number of repetitive elements detected and their type (i.e., SINE, Line, etc.), among other parameters.

21. Identification of Genomic Islands

The web server Island Viewer28 is a sound tool to detect and identify genomic islands (GI) in prokaryotic genomes. With this tool, it is possible to predict and interactively visualize GIs. It is based in different tools (IslandViewer, IslandPick, SIGI-HMM, IslandPath-DIMOB and Islander), is very intuitive and you just need to upload the genome annotations in EMBL or GenBank formats. For example, if you have employed Bakta for genome annotations and followed this pipeline, you can upload the files named samplename.embl. We recommend following the suggestions made by the web developers.

Footnotes

  1. De Coster, W., D’Hert, S., Schultz, D.T, Cruts, M., Van Broeckhoven, C. (2018) NanoPack: visualizing and processing long-read sequencing data, Bioinformatics, 34:2666–2669, https://doi.org/10.1093/bioinformatics/bty149↩︎

  2. De Coster, W., Rademakers, R. (2023) NanoPack2: population-scale evaluation of long-read sequencing data, Bioinformatics, 39:btad311, https://doi.org/10.1093/bioinformatics/btad311↩︎

  3. Kolmogorov, M., Yuan, J., Lin, Y., Pevzner, P. (2019) Assembly of Long Error-Prone Reads Using Repeat Graphs. Nature Biotechnology, 37: 540–546. https://doi.org/10.1038/s41587-019-0072-8↩︎

  4. Mikheenko, A., Saveliev, V., Hirsch, P., Gurevich, A., (2023) WebQUAST: online evaluation of genome assemblies, Nucleic Acids Research, 51:W601–W606, https://doi.org/10.1093/nar/gkad406↩︎

  5. Chklovski, A., Parks, D.H., Woodcroft, B.J. et al., (2023) CheckM2: a rapid, scalable and accurate tool for assessing microbial genome quality using machine learning. Nat Methods 20, 1203–1212. https://doi.org/10.1038/s41592-023-01940-w↩︎

  6. Chaumeil, P.A., Mussig, A.J., Hugenholtz, P., Parks, D.H. (2023) GTDB-Tk v2: memory friendly classification with the genome taxonomy database, Bioinformatics, 38:5315–5316, https://doi.org/10.1093/bioinformatics/btac672↩︎

  7. Meier-Kolthoff, J.P., Göker, M. (2019) TYGS is an automated high-throughput platform for state-of-the-art genome-based taxonomy. Nat Commun 10, 2182. https://doi.org/10.1038/s41467-019-10210-3↩︎

  8. Richter, M., Rosselló-Móra, R., Glöckner, F.O., Peplies, J., (2016) JSpeciesWS: a web server for prokaryotic species circumscription based on pairwise genome comparison, Bioinformatics, 32:929–931, https://doi.org/10.1093/bioinformatics/btv681↩︎

  9. Zankari, E., Hasman, H., Cosentino, S., Vestergaard, M., Rasmussen, S., et al., (2012) Identification of acquired antimicrobial resistance genes. J Antimicrob Chemother. 67:2640-4. https://doi.org/10.1093/jac/dks261↩︎

  10. Florensa, A.F., Kaas, R.S., Clausen, P.T.L.C., Aytan-Aktug, D., Aarestrup., F.M. (2022). ResFinder – an open online resource for identification of antimicrobial resistance genes in next-generation sequencing data and prediction of phenotypes from genotypes. Microbial Genomics 8:000748. https://doi.org/10.1099/mgen.0.000748↩︎

  11. Schwengers, O., Barth, P., Falgenhauer, L., Hain, T., Chakraborty, T., Goesmann, A. (2020). Platon: identification and characterization of bacterial plasmid contigs in short-read draft assemblies exploiting protein sequence-based replicon distribution scores. Microbial Genomics, 95:295. https://doi.org/10.1099/mgen.0.000398↩︎

  12. Néron, B., Littner, E., Haudiquet, M., Perrin, A., Cury, J., Rocha, E.P.C., (2022) IntegronFinder 2.0: Identification and Analysis of Integrons across Bacteria, with a Focus on Antibiotic Resistance in Klebsiella. Microorganisms 10:700. https://doi.org/10.3390/microorganisms10040700↩︎

  13. Ho, S.F.S., Wheeler, N.E., Millard, A.D. et al., (2023) Gauge your phage: benchmarking of bacteriophage identification tools in metagenomic sequencing data. Microbiome 11, 84 https://doi.org/10.1186/s40168-023-01533-x↩︎

  14. Versoza, C.J., Pfeifer, S.P., (2022) Computational Prediction of Bacteriophage Host Ranges. Microorganisms 10:149. https://doi.org/10.3390/microorganisms10010149.↩︎

  15. Camargo, A.P., Roux, S., Schulz, F. et al., (2024) Identification of mobile genetic elements with geNomad. Nat Biotechnol 42:1303–1312. https://doi.org/10.1038/s41587-023-01953-y↩︎

  16. Zhou, S., Liu, B., Zheng, D., Chen, L., Yang, J., (2025) VFDB 2025: an integrated resource for exploring anti-virulence compounds. Nucleic Acids Res. 53:D871-D877. https://doi.org/10.1093/nar/gkae968↩︎

  17. Schwengers, O., Jelonek, L., Dieckmann, M.A., Beyvers, S., Blom, J., Goesmann, A,. (2021). Bakta: rapid and standardized annotation of bacterial genomes via alignment-free sequence identification. Microbial Genomics, 7:000685. https://doi.org/10.1099/mgen.0.000685↩︎

  18. Cantalapiedra, C.P., Hernández-Plaza, A., Letunic, I., Bork, p., Huerta-Cepas, J., (2021) eggNOG-mapper v2: Functional Annotation, Orthology Assignments, and Domain Prediction at the Metagenomic Scale, Molecular Biology and Evolution, 38:5825–5829. https://doi.org/10.1093/molbev/msab293↩︎

  19. Huerta-Cepas, J., Szklarczyk, D., Heller, D., Hernández-Plaza, A., Forslund, S.K., et al., (2019), eggNOG 5.0: a hierarchical, functionally and phylogenetically annotated orthology resource based on 5090 organisms and 2502 viruses, Nucleic Acids Research, 47:D309–D314, https://doi.org/10.1093/nar/gky1085↩︎

  20. Abby, S., Cury, J., Guglielmini, J. et al., (2016) Identification of protein secretion systems in bacterial genomes. Sci Rep 6:23080. https://doi.org/10.1038/srep23080↩︎

  21. Abby, S.S., Néron, B., Ménager, H., Touchon, M., Rocha, E.P.C., (2014). MacSyFinder: A Program to Mine Genomes for Molecular Systems with an Application to CRISPR-Cas Systems. PLoS ONE, 9:e110726. https://doi.org/doi:10.1371/journal.pone.0110726↩︎

  22. Blin, K., Shaw, S., Vader, L., Szenei, J., Reitz, Z.L., et al., antiSMASH 8.0: extended gene cluster detection capabilities and analyses of chemistry, enzymology, and regulation, Nucleic Acids Research, 53:W32–W38, https://doi.org/10.1093/nar/gkaf334↩︎

  23. Zheng, J., Ge, Q., Yan, Y., Zhang, X., Huang, L., Yin, Y. (2023) dbCAN3: automated carbohydrate-active enzyme and substrate annotation, Nucleic Acids Research, 51: W115–W121, https://doi.org/10.1093/nar/gkad328↩︎

  24. Urban, M., Cuzick, A., Seager, J., Nonavinakere, N., Sahoo, J., et al., (2025) PHI-base – the multi-species pathogen–host interaction database in 2025, Nucleic Acids Research, 53:D826–D838, https://doi.org/10.1093/nar/gkae1084↩︎

  25. Patz, S., Gautam, A., Becker, M., Ruppel, S., Rodríguez-Palenzuela, P., Huson, D.H. (2021) PLaBAse: A comprehensive web resource for analyzing the plant growth-promoting potential of plant-associated bacteria. bioRxiv 2472471. https://doi.org/10.1101/2021.12.13.472471↩︎

  26. Flynn, J.M., Hubley, R., Goubert, C., J. Rosen, Clark, A.G., Feschotte, C., Smit, A.F. (2020) RepeatModeler2 for automated genomic discovery of transposable element families, Proc. Natl. Acad. Sci. U.S.A. 117:9451-9457, https://doi.org/10.1073/pnas.1921046117.↩︎

  27. Tarailo-Graovac, M., Chen, N., (2009) Using RepeatMasker to identify repetitive elements in genomic sequences. Curr Protoc Bioinformatics. 4:4.10.1-4.10.14. https://doi.org/10.1002/0471250953.bi0410s25.↩︎

  28. Bertelli, C., Laird, M.R., Williams, K.P., Simon Fraser University Research Computing Group, Lau, B.Y., et al., (2017) IslandViewer 4: expanded prediction of genomic islands for larger-scale datasets, Nucleic Acids Research, 45:W30–W35, https://doi.org/10.1093/nar/gkx343↩︎